| Protein or peptide name: | KdpF |
| Chromosome: | Mycobacterium_bovis_AF2122/97 |
| Protein or peptide start site: | 1152395 |
| Protein or peptide end site: | 1152487 |
| ncRNA start site: | 1152395 |
| ncRNA end site: | 1152487 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MTTVDNIVGLVIAVALMAFLFAALLFPEKF |
| Protein or peptide length: | 30aa |
| ncRNA type: | ncRNA |
| ncRNA name: | kdpF |
| Entrez ID: | 3205056 |
| Experimental species: | Mycobacterium tuberculosis |
| Experimental techniques: | Western blotting |
| Experimental sample (cell line and/or tissue): | Mycobacterium bovis BCG |
| Description: | The 30 amino-acid-long KdpF peptide, which is co-transcribed with kdpABC genes and regulated by the KdpDE two-component system, is supposed to stabilize the KdpABC potassium transporter complex but may also exhibit unsuspected regulatory function (s) towards the KdpD sensor kinase. |
| Subcellular location: | membrane |
| Function: | KdpF overexpression reduces intramacrophage growth which may result from alteration of the mycobacterial cell wall. |
| Title of paper: | Overexpression of the KdpF membrane peptide in Mycobacterium bovis BCG results in reduced intramacrophage growth and altered cording morphology |
| PMID: | 23577107 |
| Year of publication: | 2013 |
